Cat: PAX2000-12660

Recombinant Human ZDHHC12 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ZDHHC12

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ZDHHC12; ZNF400; PSEC0008; Palmitoyltransferase ZDHHC12; DHHC domain-containing cysteine-rich Protein 12; DHHC-12; Zinc finger DHHC domain-containing Protein 12; Zinc finger Protein 400

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96GR4

  • Expression Region

    1-322 aa

  • AA Sequence

    MAPWALLSPGVLVRTGHTVLTWGITLVLFLHDTDKSADELLATHSHSWNQHLQAFAQPGTHFPTSNCTPTPPTPVLPGPASLCSPASPELRQWEEQGELLLPLTFLLLVLGSLLLYLAVSLMDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVVYLALQLVVLLWGLYLAWSGLRFFQPWGLWLRSSGLLFATFLLLSLFSLVASLLLVSHLYLVASNTTTWEFISSHRIAYLRQRPSNPFDRGLTRNLAHFFCGWPSGSWETLWAEEEEEGSSPAV

  • Molecular Weight

    62.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ZDHHC12, a member of the Zinc Finger DHHC-type Palmitoyltransferase family, has garnered significant attention in recent years due to its role in post-translational modification processes, particularly palmitoylation. This modification, characterized by the addition of palmitic acid to cysteine residues, is crucial for membrane localization, protein stability, and cellular signaling. Dysregulation of palmitoylation has been implicated in various diseases, including cancer and neurodegenerative disorders. Research into ZDHHC12 has highlighted its importance in neuronal development and function, as well as its potential involvement in tumorigenesis. Studies reveal that ZDHHC12 can influence the activity of various signaling pathways, thereby affecting cell growth and differentiation. The understanding of ZDHHC12’s structure and function is vital for elucidating its biological roles and potential as a therapeutic target. As a result, the recombinant production of ZDHHC12 protein has become an essential focus for investigating its biochemical properties and interactions with other cellular components, paving the way for future studies aimed at targeting palmitoylation-related pathways for therapeutic interventions. Through these investigations, researchers aim to uncover the molecular mechanisms by which ZDHHC12 contributes to cellular homeostasis and disease progression, ultimately enhancing our understanding of the complexities of protein modification in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US