Analytical Data
-
Gene name
ZDHHC12
- Application
-
Alternative Names
ZDHHC12; ZNF400; PSEC0008; Palmitoyltransferase ZDHHC12; DHHC domain-containing cysteine-rich Protein 12; DHHC-12; Zinc finger DHHC domain-containing Protein 12; Zinc finger Protein 400
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96GR4
-
Expression Region
1-322 aa
-
AA Sequence
MAPWALLSPGVLVRTGHTVLTWGITLVLFLHDTDKSADELLATHSHSWNQHLQAFAQPGTHFPTSNCTPTPPTPVLPGPASLCSPASPELRQWEEQGELLLPLTFLLLVLGSLLLYLAVSLMDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVVYLALQLVVLLWGLYLAWSGLRFFQPWGLWLRSSGLLFATFLLLSLFSLVASLLLVSHLYLVASNTTTWEFISSHRIAYLRQRPSNPFDRGLTRNLAHFFCGWPSGSWETLWAEEEEEGSSPAV
-
Molecular Weight
62.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZDHHC12, a member of the Zinc Finger DHHC-type Palmitoyltransferase family, has garnered significant attention in recent years due to its role in post-translational modification processes, particularly palmitoylation. This modification, characterized by the addition of palmitic acid to cysteine residues, is crucial for membrane localization, protein stability, and cellular signaling. Dysregulation of palmitoylation has been implicated in various diseases, including cancer and neurodegenerative disorders. Research into ZDHHC12 has highlighted its importance in neuronal development and function, as well as its potential involvement in tumorigenesis. Studies reveal that ZDHHC12 can influence the activity of various signaling pathways, thereby affecting cell growth and differentiation. The understanding of ZDHHC12’s structure and function is vital for elucidating its biological roles and potential as a therapeutic target. As a result, the recombinant production of ZDHHC12 protein has become an essential focus for investigating its biochemical properties and interactions with other cellular components, paving the way for future studies aimed at targeting palmitoylation-related pathways for therapeutic interventions. Through these investigations, researchers aim to uncover the molecular mechanisms by which ZDHHC12 contributes to cellular homeostasis and disease progression, ultimately enhancing our understanding of the complexities of protein modification in health and disease.
