Analytical Data
-
Gene name
PLXNB1
- Application
-
Alternative Names
PLXNB1；KIAA0407；PLXN5；SEP；Plexin-B1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43157
-
Expression Region
20-535aa
-
AA Sequence
LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQ
-
Molecular Weight
83.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLXNB1, or Plexin-B1, is a member of the plexin family of proteins, which are key mediators in the signaling pathways of semaphorins, a group of axon guidance molecules. Research on PLXNB1 has gained importance due to its involvement in various physiological and pathological processes, including neuronal development, immune responses, and cancer progression. PLXNB1 functions by facilitating cellular signaling through its interaction with semaphorin ligands, which significantly influences cell migration, growth, and differentiation. Utilizing recombinant protein technology enables researchers to produce and study PLXNB1 in controlled environments, allowing for detailed analysis of its structural and functional properties. Investigating PLXNB1's role may reveal insights into its potential as a therapeutic target for diseases characterized by aberrant cell signaling and migration, such as tumors or neurodegenerative disorders. As such, studies focusing on the recombinant expression, purification, and functional assays of PLXNB1 will contribute to a deeper understanding of its biological roles and potential clinical applications.
