Analytical Data
-
Gene name
PLXNA1
- Application
-
Alternative Names
PLXNA1;NOV;PLXN1;Plexin-A1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UIW2
-
Expression Region
986-1152aa
-
AA Sequence
LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQL TNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKY GGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRS LLVLNSTSFLYYPDPVL
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLXNA1, also known as plexin A1, is a receptor involved in various cellular processes, including cell migration, axon guidance, and immune responses. It serves as a receptor for semaphorins, a family of proteins that play crucial roles in developmental signaling and neuronal patterning. Dysregulation of PLXNA1 has been associated with several pathological conditions, including cancer metastasis, cardiovascular diseases, and neurological disorders. Researchers have been increasingly focusing on recombinant PLXNA1 proteins to understand their structural and functional properties better. By expressing and purifying PLXNA1 in various systems, scientists aim to elucidate its role in semaphorin signaling pathways and uncover potential therapeutic targets. Additionally, recombinant PLXNA1 can be utilized in biochemical assays and structural studies, providing insights into its interaction with ligands and downstream signaling molecules. The investigation of PLXNA1 is critical for advancing our knowledge of cellular communication mechanisms and developing novel strategies for treating diseases related to its dysfunction.











