Analytical Data
-
Gene name
EI24
- Application
-
Alternative Names
EI24; PIG8; Etoposide-induced protein 2.4 homolog; p53-induced gene 8 protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14681
-
Expression Region
1-340aa
-
AA Sequence
MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATSGH
-
Molecular Weight
63.14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EI24, a protein involved in various cellular processes, has garnered significant attention in recent years due to its role in the regulation of autophagy and its potential implications in cancer biology. Initially identified as a gene upregulated in response to stress, EI24 has been linked to the modulation of cellular homeostasis and the immune response. Researchers have demonstrated its involvement in the endoplasmic reticulum (ER) stress response, suggesting that it plays a critical role in maintaining cellular integrity under adverse conditions. Investigations into the structure and functional properties of EI24 have revealed its interactions with key molecular pathways, further implicating it in tumorigenesis and the progression of several malignancies. As a result, EI24 has emerged as a potential biomarker for cancer diagnosis and prognosis, with ongoing studies aimed at elucidating its mechanistic roles and exploring its utility in therapeutic strategies. The growing body of evidence surrounding EI24 highlights its importance in advancing our understanding of cellular processes and disease mechanisms, making it a focal point for future research in both basic biology and clinical applications.
