Analytical Data
-
Gene name
ZCWPW2
- Application
-
Alternative Names
ZCPW2_HUMAN; ZCW2; ZCWPW2; Zinc finger CW type with PWWP domain 2; Zinc finger CW-type PWWP domain Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q504Y3
-
Expression Region
1-356 aa
-
AA Sequence
MDKEKLDVKIEYCNYAMDSSVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDFPEESQLHQCGFKIVYSQLPLGSLVLVKLQNWPSWPGILCPDRFKGKYVTYDPDGNVEEYHIEFLGDPHSRSWIKATFVGHYSITLKPEKCKNKKKWYKSALQEACLLYGYSHEQRLEMCCLSKLQDKSETHDKVAALVKKRKQTSKNNIEKKKPKFRKRKRKAILKCSFENVYSDDALSKENRVVCETEVLLKELEQMLQQALQPTATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEIDALMSEF
-
Molecular Weight
67.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZCWPW2 is a protein implicated in various biological processes, including cell regulation and development. Recent studies have highlighted its role in mediating cellular responses to stress and its involvement in pathways related to cancer progression. The understanding of ZCWPW2's function and interactions is crucial, as it may serve as a potential biomarker or therapeutic target in diseases where its regulatory mechanisms are disrupted. Research has focused on recombinant ZCWPW2 proteins to elucidate their structural and functional characteristics, utilizing techniques such as protein expression in model systems and biochemical assays to investigate their activity. By producing and characterizing these recombinant proteins, scientists aim to gain insights into the molecular mechanisms governing ZCWPW2's role in cellular processes, providing a foundation for future therapeutics targeting related pathways in cancer and other diseases. The development of ZCWPW2 as a research tool also opens avenues for studying its interaction with other cellular components, paving the way for a deeper understanding of its biological significance and potential applications in the biomedical field.
