Cat: PA1000-8171

Recombinant Human CRHR1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CRHR1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CRHR1;CRFR;CRFR1;CRHR;Corticotropin-releasing factor receptor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P34998-2

  • Expression Region

    1-415aa

  • AA Sequence

    MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDL IGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYS ECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCL RNIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHV TNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGK LYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSF LESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTS PTRVSFHSIKQSTAV

  • Molecular Weight

    74 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CRHR1 (Corticotropin-Releasing Hormone Receptor 1) is a critical component of the hypothalamic-pituitary-adrenal (HPA) axis, playing a pivotal role in regulating stress responses and maintaining homeostasis. This receptor is activated by corticotropin-releasing hormone (CRH), which triggers a cascade of physiological events that influence mood, anxiety, and behavior. Dysregulation of CRHR1 has been implicated in various neuropsychiatric disorders, including depression, anxiety, and post-traumatic stress disorder (PTSD). Given its central role in stress-related pathways, CRHR1 has emerged as a promising target for therapeutic intervention. Researchers have focused on characterizing the receptor's structure, function, and downstream signaling mechanisms. The development of recombinant CRHR1 proteins has allowed for more detailed studies of ligand-receptor interactions and the effects of various pharmacological agents. Additionally, understanding the receptor's role in different cell types and its potential genetic polymorphisms contributes to insights into individual variability in stress responses and susceptibility to mental health disorders. As such, CRHR1 remains an active area of investigation in both basic and clinical research, with the aim of uncovering novel strategies for the treatment of stress-related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US