Analytical Data
-
Gene name
TEX264
- Application
-
Alternative Names
Testis-expressed Protein 264. Putative secreted Protein Zsig11
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6I9
-
Expression Region
1-313 aa
-
AA Sequence
MSDLLLLGLIGGLTLLLLLTLLAFAGYSGLLAGVEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSISPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE
-
Molecular Weight
60.17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TEX264, a protein associated with the endoplasmic reticulum (ER), has garnered attention in recent years due to its potential roles in cellular processes such as protein homeostasis, stress response, and autophagy. As an integral player in the regulation of ER-associated degradation (ERAD), TEX264 is believed to facilitate the selective degradation of misfolded proteins, thus maintaining cellular integrity. Research has indicated that TEX264 may interact with various molecular pathways, influencing the cell’s ability to cope with stress and potentially contributing to the progression of diseases, including neurodegenerative disorders and cancer. The understanding of TEX264's structure and function has implications for developing therapeutic strategies aimed at enhancing cellular resilience or targeting dysfunctional pathways. This highlights the importance of purifying and characterizing recombinant TEX264 protein to study its biological functions and interactions more comprehensively, opening avenues for new insights into its role in cellular health and disease mechanisms. As such, ongoing research into TEX264 offers valuable potential for both basic science and translational applications in biomedical fields.
