Analytical Data
-
Gene name
FMR1
- Application
-
Alternative Names
FMR1；Fragile X messenger ribonucleoProtein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IXW7
-
Expression Region
1-297aa
-
AA Sequence
MEELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPDRQIPFHDVRFP PPVGYNKDINESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACD ATYNEIVTIERLRSVNPNKPATKDTFHKIKLDVPEDLRQMCAKEAAHKDF KKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM RNEEASKQLESSRQLASRFHEQFIVREDLMGLAIGTHGANIQQARKVPGV TAIDLDEDTCTFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGLKI
-
Molecular Weight
58 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FMR1, or Fragile X Mental Retardation 1, is a critical gene located on the X chromosome, and its expanded CGG repeat sequence is linked to Fragile X Syndrome, the most common inherited form of intellectual disability. The protein produced by the FMR1 gene, known as FMRP (Fragile X Mental Retardation Protein), plays a significant role in neuronal function and synaptic plasticity by regulating the translation of specific mRNAs at synapses. Research on FMR1 recombinant proteins has gained momentum as scientists seek to understand the molecular mechanisms underlying its involvement in neural signaling and its association with cognitive deficits. In various models, including cellular and animal models, FMRP's function in RNA binding and regulation has been explored, advancing our knowledge of how its absence leads to the cognitive impairments seen in Fragile X Syndrome. Additionally, FMR1 research has broad implications, as it contributes not only to our understanding of Fragile X but also offers insights into related neurodevelopmental disorders. The exploration of FMR1 recombinant proteins aids in developing potential therapeutic strategies aimed at mitigating the symptoms associated with Fragile X Syndrome, highlighting the importance of continued investigation in this field.
