Analytical Data
-
Gene name
ZCCHC24
- Application
-
Alternative Names
ZCCHC24; C10orf56; Zinc finger CCHC domain-containing Protein 24
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N2G6
-
Expression Region
1-241 aa
-
AA Sequence
MSLLSAIDTSAASVYQPAQLLNWVYLSLQDTHQASAFDAFRPVPTAGAAPPELAFGKGRPEQLGSPLHSSYLNSFFQLQRGEALSNSVYKGASPYGSLNNIADGLSSLTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMSGNSWANMGQECIKCHINVYPHKQRPLEKPDGLDVSDQSKEHPQHLCEKCKVLGYYCRRVQ
-
Molecular Weight
26.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZCCHC24, a member of the zinc finger CCHC-type containing protein family, has been implicated in various biological processes, including RNA metabolism and regulation. Recent studies have highlighted its role in modulating gene expression and influencing cellular responses to environmental stimuli. Dysregulation of ZCCHC24 has been associated with several diseases, including cancer, which underscores its potential as a therapeutic target. Furthermore, the study of ZCCHC24's protein structure and function is crucial for understanding its mechanisms of action at the molecular level. Researchers are particularly interested in exploring its interactions with RNA and other cellular proteins, as these interactions may provide insights into its role in cellular signaling pathways and gene regulation. As a result, the characterization of ZCCHC24 as a recombinant protein is essential for elucidating its functional roles and therapeutic potential, making it a significant focus in molecular biology and biomedical research.
