Analytical Data
-
Gene name
EFEMP2
- Application
-
Alternative Names
EFEMP 2; EFEMP2; EGF containing fibulin like extracellular matrix protein 2; EGF-containing fibulin-like extracellular matrix protein 2; FBLN 4; FBLN4; FBLN4_HUMAN; FIBL
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95967
-
Expression Region
1-229aa
-
AA Sequence
MGAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYIQVSENRCLCPASNPLCREQPSSIVHRYMTITSERSVPADVFQIQATSVYPGAYNAFQIRAGPRPAGDGPPGVRAGPGDGHHEFPHELPGQLCTEAHRLCRGLHLLRSRREPPSLHLP
-
Molecular Weight
52 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EFEMP2, or EGF-containing fibulin-like extracellular matrix protein 2, is a member of the fibulin family, which plays a crucial role in the structure and function of the extracellular matrix (ECM). This protein is involved in various biological processes, including cell adhesion, migration, and tissue remodeling. Studies have shown that EFEMP2 is expressed in several tissues, notably in the eye and skin, and has been linked to the development of certain diseases, including age-related macular degeneration (AMD) and connective tissue disorders. Its role in ECM organization suggests that dysregulation of EFEMP2 may contribute to pathologies characterized by altered tissue architecture. Recent research has focused on the potential therapeutic applications of EFEMP2 recombinant proteins in regenerative medicine and tissue engineering, aiming to harness their properties for promoting wound healing and modulating inflammatory responses. Understanding the precise mechanisms of EFEMP2's function and its interactions within the ECM is crucial for developing innovative treatments for degenerative diseases and improving tissue repair strategies. Consequently, recombinant EFEMP2 proteins are being investigated for their capacity to enhance cell behavior and tissue regeneration, paving the way for novel therapeutic approaches.
