Analytical Data
-
Gene name
ZBTB8OS
- Application
-
Alternative Names
ARCH; ARCH_HUMAN; ARCH2; Archease (ARCH); Archease like Protein; MGC62007; OTTHUMP00000036124; Protein archease; Protein ZBTB8OS; ZBTB8OS; Zinc finger and BTB domain containing 8 opposite strand; Zinc finger and BTB domain containing opposite strand Protein 8; Zinc finger and BTB domain-containing opposite strand Protein 8
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IWT0
-
Expression Region
1-136 aa
-
AA Sequence
MAQEEEDVRDYNLTEEQKAIKAKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLQTVEVETQGDDLQSLLFHFLDEWLYKFSADEFFIPRVGRRIFIVQAPSGNRSQSNNIFSNAGL
-
Molecular Weight
42.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZBTB8OS, a long non-coding RNA, has garnered considerable interest in recent years due to its potential roles in various biological processes, including gene regulation, cancer progression, and immune responses. Originally identified as an oncogene, ZBTB8OS is associated with the regulation of key pathways involved in cell proliferation and survival. Research has shown that its aberrant expression is linked to several types of cancers, making it a potential biomarker and therapeutic target. Moreover, studies suggest that ZBTB8OS may interact with various proteins and other RNA molecules, influencing cellular functions and contributing to the complexity of gene expression regulation. Understanding the precise mechanisms governing ZBTB8OS function could provide insights into the molecular underpinnings of tumorigenesis and open avenues for novel treatment strategies. As such, the recombinant protein studies of ZBTB8OS are essential for elucidating its functional roles, enabling researchers to investigate its interactions with other cellular components, and assessing its potential as a target for drug development. This research not only aims to clarify the biological significance of ZBTB8OS but also seeks to contribute to a broader understanding of long non-coding RNAs in health and disease.
