Analytical Data
-
Gene name
ECG2
- Application
-
Alternative Names
SPINK7; ECG2; UNQ745/PRO1474; Serine protease inhibitor Kazal-type 7; Esophagus cancer-related gene 2 protein; ECRG-2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P58062
-
Expression Region
1-85aa
-
AA Sequence
MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC
-
Molecular Weight
35.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ECG2 recombinant protein, a key component in the study of cardiovascular biology, has garnered significant attention due to its potential therapeutic applications in heart-related conditions. ECG2, derived from the human genome, plays a critical role in various physiological processes, including cardiac muscle contraction and the regulation of heart rhythm. The increasing prevalence of cardiovascular diseases globally necessitates innovative approaches to treatment and prevention. Researchers have been exploring the structure-function relationship of ECG2 to understand its molecular mechanisms and interactions within the cardiac environment. The recombinant form of the protein allows for detailed in vitro studies, facilitating the assessment of its functional properties and potential as a biomarker or therapeutic target. Advances in recombinant DNA technology have made it feasible to produce large quantities of ECG2, enabling extensive research into its role in cardiomyocyte survival, proliferation, and response to stress stimuli. This ongoing research not only aims to illuminate the intricate pathways involved in heart diseases but also to pave the way for new intervention strategies that could enhance cardiac health and improve outcomes for patients with heart disorders. The findings from ECG2 studies hold promise for contributing to the development of novel therapies aimed at mitigating the burden of cardiovascular diseases, ultimately benefiting public health on a global scale.











