Cat: PA2000-7268

Recombinant Human ECG2 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ECG2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SPINK7; ECG2; UNQ745/PRO1474; Serine protease inhibitor Kazal-type 7; Esophagus cancer-related gene 2 protein; ECRG-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P58062

  • Expression Region

    1-85aa

  • AA Sequence

    MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC

  • Molecular Weight

    35.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ECG2 recombinant protein, a key component in the study of cardiovascular biology, has garnered significant attention due to its potential therapeutic applications in heart-related conditions. ECG2, derived from the human genome, plays a critical role in various physiological processes, including cardiac muscle contraction and the regulation of heart rhythm. The increasing prevalence of cardiovascular diseases globally necessitates innovative approaches to treatment and prevention. Researchers have been exploring the structure-function relationship of ECG2 to understand its molecular mechanisms and interactions within the cardiac environment. The recombinant form of the protein allows for detailed in vitro studies, facilitating the assessment of its functional properties and potential as a biomarker or therapeutic target. Advances in recombinant DNA technology have made it feasible to produce large quantities of ECG2, enabling extensive research into its role in cardiomyocyte survival, proliferation, and response to stress stimuli. This ongoing research not only aims to illuminate the intricate pathways involved in heart diseases but also to pave the way for new intervention strategies that could enhance cardiac health and improve outcomes for patients with heart disorders. The findings from ECG2 studies hold promise for contributing to the development of novel therapies aimed at mitigating the burden of cardiovascular diseases, ultimately benefiting public health on a global scale.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US