Analytical Data
-
Gene name
MOGAT2
- Application
-
Alternative Names
MOGAT2；DC5；DGAT2L5；2-acylglycerol O-acyltransferase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3SYC2
-
Expression Region
1-334aa
-
AA Sequence
MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSGSWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEEVNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC
-
Molecular Weight
38.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MOGAT2, or monoacylglycerol O-acyltransferase 2, is an enzyme that plays a crucial role in lipid metabolism, particularly in the synthesis of triacylglycerols (TAGs) from monoacylglycerols (MAGs) and acyl-CoA substrates. Understanding MOGAT2's function and regulation is vital due to its implications in metabolic disorders such as obesity, diabetes, and cardiovascular diseases. The enzyme is involved in the endocannabinoid system, contributing to the modulation of various physiological processes including appetite regulation and energy homeostasis. Research has revealed that dysregulation of MOGAT2 may lead to altered lipid profiles and increased risk of metabolic diseases. Consequently, MOGAT2 has emerged as a potential therapeutic target for drug development aimed at managing obesity and its associated conditions. Studies involving the recombinant expression of MOGAT2 proteins facilitate the investigation of its biochemical properties, enzyme kinetics, and interaction with other metabolic pathways. Furthermore, understanding the structural characteristics of MOGAT2 through techniques such as X-ray crystallography and cryo-electron microscopy could offer insights into its mechanism of action, guiding the design of specific inhibitors or modulators. Overall, ongoing research on MOGAT2 aims to elucidate its role in lipid metabolism and its potential as a target for therapeutic interventions in metabolic diseases.
