Analytical Data
-
Gene name
MGL
- Application
-
Alternative Names
MGL;NDNL1;MAGE-like Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99685
-
Expression Region
1-303aa
-
AA Sequence
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
-
Molecular Weight
60.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MGL (monoacylglycerol lipase) is an enzyme that plays a crucial role in lipid metabolism by hydrolyzing monoacylglycerols into free fatty acids and glycerol. This process is significant in regulating endocannabinoid levels, impacting various physiological functions such as pain sensation, appetite, and inflammation. MGL is implicated in several pathological conditions, including obesity, cancer, and neurological disorders, which has garnered interest in its potential as a therapeutic target. Recent advancements in recombinant protein technology have enabled the production of functional MGL in heterologous systems, facilitating detailed investigations of its structure, enzymatic activity, and inhibition mechanisms. Researchers are exploring MGL inhibitors as promising candidates for drug development to combat diseases linked to endocannabinoid dysregulation. Studies on MGL are also contributing to our understanding of lipid signaling pathways, highlighting its importance in both basic and applied biomedical research. As a result, MGL remains a focal point in the study of lipid biology, providing insights that could lead to innovative treatments for a variety of health issues.











