Analytical Data
-
Gene name
EBF4
- Application
-
Alternative Names
EBF4; COE4; KIAA1442; Transcription factor COE4; Early B-cell factor 4; EBF-4; Olf-1/EBF-like 4; O/E-4; OE-4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQW3
-
Expression Region
1-88aa
-
AA Sequence
MPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISAVKQRSAFAPVLRPPSSPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS
-
Molecular Weight
35.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EBF4 (Early B-cell Factor 4) is a pivotal transcription factor playing a crucial role in B-cell lineage commitment and development. As a member of the EBF family, EBF4 is essential for the regulation of genes involved in B-cell differentiation, immune response, and the maintenance of healthy immune function. Abnormal expression of EBF4 has been implicated in various hematological malignancies, particularly in the context of B-cell neoplasms. Researchers are increasingly focusing on the recombinant production of EBF4 protein to elucidate its functional mechanisms and interactions with other key proteins within the B-cell signaling pathway. The availability of purified EBF4 protein is vital for in vitro studies that aim to dissect the molecular mechanisms behind its regulatory functions. In addition, understanding the structure-function relationship of EBF4 could pave the way for potential therapeutic strategies targeting related immune disorders and malignancies. Overall, the study of recombinant EBF4 protein not only enhances our understanding of B-cell biology but also contributes to the development of novel approaches in immunotherapy and cancer treatment.
