Cat: PA1000-8147

Recombinant Human CH25H Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CH25H

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CH25H;Cholesterol 25-hydroxylase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95992

  • Expression Region

    1-272aa

  • AA Sequence

    MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVG FCLPFVVLDILCSWVPALRRYKIHPDFSPSAQQLLPCLGQTLYQHVMFVF PVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFFVWHLLHHKVP WLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTT LTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNF APYFTHWDKILGTLRTASVPAR

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CH25H, or cholesterol 25-hydroxylase, is an enzyme that plays a critical role in cholesterol metabolism and homeostasis. Its primary function is to convert cholesterol into 25-hydroxycholesterol, a bioactive lipid that influences various biological processes, including immune responses, inflammation, and lipid metabolism. Research has shown that CH25H is linked to various diseases, including atherosclerosis, metabolic syndrome, and certain autoimmune disorders. Advances in biotechnology have enabled the recombinant expression of CH25H, facilitating detailed studies of its structure-function relationships and biological activities. By producing CH25H as a recombinant protein, researchers can investigate its enzymatic mechanisms, regulatory pathways, and interactions with other molecules. These studies have the potential to reveal novel therapeutic targets and strategies for treating conditions associated with dysregulated cholesterol metabolism. Understanding the physiological and pathological roles of CH25H is crucial for uncovering its potential as a biomarker and therapeutic target in various diseases, thus driving the development of innovative interventions in cardiovascular and metabolic health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US