Analytical Data
-
Gene name
EAF2
- Application
-
Alternative Names
BM 040; BM040; EAF 2; EAF2; EAF2_HUMAN; Ehrlich S II transcriptional activator factor ; ELL associated factor 2; ELL-associated factor 2; Festa; Testosterone regulated apoptosis inducer and tumor suppressor
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96CJ1
-
Expression Region
1-260aa
-
AA Sequence
MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD
-
Molecular Weight
55.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EAF2 (E2F-associated factor 2) is a crucial protein implicated in the regulation of cell cycle progression and gene expression. It has gained attention in recent years due to its potential role in tumorigenesis and cancer progression. EAF2 interacts with E2F transcription factors, which are pivotal in controlling the transition from the G1 to S phase of the cell cycle. Dysregulation of E2F activity, often caused by mutations or altered expression of its cofactors like EAF2, is associated with various cancers. Furthermore, EAF2 has been linked to mechanisms of apoptosis and cellular stress responses, making it an important player in maintaining cellular homeostasis. Recent studies have focused on the recombinant expression of EAF2 to understand its structure-function relationships and explore its therapeutic potential. By producing EAF2 as a recombinant protein, researchers aim to elucidate its biochemical properties, investigate its interactions with E2F family members, and assess its role in oncogenic pathways. Understanding EAF2’s function at the molecular level could provide insights into its potential as a biomarker for cancer diagnosis and a target for developing novel therapeutic strategies. As research continues, the hope is that advancements in EAF2 studies will lead to innovative approaches in cancer treatment, highlighting the importance of this protein in the field of oncology.
