Analytical Data
-
Gene name
DYSFIP1
- Application
-
Alternative Names
PPP1R27; DYSFIP1; Protein phosphatase 1 regulatory subunit 27; Dysferlin-interacting protein 1; Toonin
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86WC6
-
Expression Region
1-154aa
-
AA Sequence
MPSRTARYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDEAGWTPLHIACSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD
-
Molecular Weight
43.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DYSFIP1, a recently identified protein, is gaining attention due to its potential involvement in various cellular processes, including immune response and inflammation. Studies indicate that DYSFIP1 may play a role in the regulation of cytokine production and the modulation of immune cell function, suggesting its significant impact on maintaining immune homeostasis. Research into DYSFIP1 recombinant protein has been prompted by its implications in diseases where the immune system is compromised or dysregulated, such as autoimmune disorders and chronic inflammatory conditions. Understanding the structure and function of DYSFIP1 through recombinant expression could provide insights into its mechanisms of action and facilitate the development of therapeutic strategies aimed at modulating immune responses. Furthermore, the characterization of this protein may reveal novel biomarkers for disease diagnosis and prognosis, highlighting the importance of investigating DYSFIP1 in the context of both basic research and clinical applications. Overall, the study of DYSFIP1 recombinant protein is an emerging field with the potential to contribute significantly to our comprehension of immune regulation and its implications for health and disease.
