Analytical Data
-
Gene name
TCEB2
- Application
-
Alternative Names
EloB; ELOB_HUMAN; Elongin 18 kDa subunit; Elongin B; Elongin-B; RNA polymerase II transcription factor SIII p18 subunit; RNA polymerase II transcription factor SIII subunit B; SIII; SIII p18; TCEB 2; Tceb2; Transcription elongation factor B (SIII) polypeptide 2; Transcription elongation factor B polypeptide 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15370
-
Expression Region
1-118 aa
-
AA Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
-
Molecular Weight
38.72 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TCEB2, also known as Transcription Elongation Factor B polypeptide 2, plays a crucial role in the regulation of gene expression by facilitating the transcription elongation process. Its function is essential for the proper synthesis of mRNA and has been implicated in various biological processes, including cellular differentiation and proliferation. Research into TCEB2 has gained attention due to its potential connections to several diseases, particularly cancer, where aberrations in transcriptional regulation are a hallmark. Understanding the molecular mechanisms by which TCEB2 operates can provide insights into how transcriptional dysregulation occurs in oncogenesis. Additionally, TCEB2's interactions with other transcription factors and its role in the phosphorylation of RNA polymerase II highlight its significance in the transcription machinery. Furthermore, studies on recombinant TCEB2 protein production can aid in identifying novel therapeutic targets and strategies for modulating its activity, thereby contributing to cancer therapy and other disorders linked to transcriptional dysregulation. Overall, TCEB2's pivotal function in transcription makes it a focal point for research in molecular biology and medicine, with the potential to uncover new avenues for targeted treatments.
