Analytical Data
-
Gene name
EMP3
- Application
-
Alternative Names
EMP3；YMP；Epithelial membrane Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54852
-
Expression Region
1-163aa
-
AA Sequence
MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The EMP3 gene, encoding the epithelial membrane protein 3, has garnered considerable interest in cancer research due to its role in cell adhesion and tumor progression. EMP3 is predominantly expressed in epithelial tissues, and its expression levels have been shown to correlate with various malignancies, including breast and colorectal cancers. Researchers believe that alterations in EMP3 expression may contribute to the epithelial-to-mesenchymal transition (EMT), a key process in cancer metastasis. Studies have demonstrated that EMP3 can function either as a tumor suppressor or as a promoter of oncogenic processes, depending on the cellular context and specific tumor type. This paradoxical role necessitates a deeper understanding of its molecular mechanisms and interactions in order to evaluate its potential as a therapeutic target. Recent advances in recombinant protein technology have enabled the production of EMP3 proteins for in-depth functional assays and structural analyses. By investigating the biochemical properties and interaction networks of EMP3, scientists aim to elucidate its precise function in tumor biology, paving the way for innovative strategies in cancer diagnosis and treatment. Consequently, the study of EMP3 not only sheds light on fundamental cancer biology but also holds promise for the development of novel therapeutic interventions that could enhance patient outcomes.
