Analytical Data
-
Gene name
EGF
- Application
-
Alternative Names
EGF;Pro-epidermal growth factor
-
Species
Human
-
Source
E. coli
-
Tag
N-terminal His Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18846
-
Expression Region
609~751aa
-
AA Sequence
AKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCDAK QSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGK DRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGG
-
Molecular Weight
17.3kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
Epidermal growth factor (EGF) is a key peptide involved in cell growth, proliferation, and differentiation, making it a critical element in various biological processes. The study of recombinant EGF protein has gained traction due to its potential applications in regenerative medicine, wound healing, and cancer therapy. Recombinant technology allows for the expression of EGF in a controlled manner, enabling the production of high-purity and active forms of the protein. Understanding its role in cellular signaling pathways has opened avenues for therapeutic interventions, as EGF can influence epithelial cell behavior and tissue repair mechanisms. Moreover, advancements in biotechnology have enhanced the ability to produce this protein efficiently, reducing costs and improving availability for research and clinical applications. As EGF's significance in dermatology and oncology becomes more apparent, ongoing research focuses on optimizing its formulation and delivery methods to maximize efficacy while minimizing side effects. The integration of EGF in various therapeutic strategies continues to be a promising area of exploration in biotechnology and medicine.












