Analytical Data
-
Gene name
DUSP24
- Application
-
Alternative Names
DSP-4; Dual specificity phosphatase 26 (putative); Dual specificity phosphatase 26; Dual specificity phosphatase SKRP3; Dual specificity protein phosphatase 26; DUS26_HUMAN; DUSP24; DUSP26; Hypothetical protein FLJ31142; LDP 4; LDP-4; Low molecular mass dual specificity phosphatase 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BV47
-
Expression Region
1-313aa
-
AA Sequence
MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY
-
Molecular Weight
59.95 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DUSP24 (Dual Specificity Phosphatase 24) is a member of the dual-specificity phosphatase family, which plays crucial roles in cellular signaling by inactivating mitogen-activated protein kinases (MAPKs) through dephosphorylation. Research on DUSP24 has gained prominence due to its potential implications in various physiological processes and diseases, including cancer, inflammatory responses, and neurodegenerative conditions. Unlike classical phosphatases, DUSP24 is unique in its ability to specifically dephosphorylate both tyrosine and serine/threonine residues, adding complexity to its regulatory functions. Its expression is tightly regulated in tissues, suggesting a functional role in development and response to environmental stimuli. Investigating the structure and function of recombinant DUSP24 protein can provide insights into its enzymatic mechanisms and substrate specificity. Such studies may pave the way for therapeutic strategies targeting MAPK signaling pathways, which are often dysregulated in various diseases. In summary, understanding DUSP24 through recombinant protein research is pivotal for elucidating its biological significance and developing potential interventions in related pathologies.
