Analytical Data
-
Gene name
DUPD1
- Application
-
Alternative Names
Atypical dual specific protein phosphatase; Dual specificity phosphatase 27; Dual specificity phosphatase and pro isomerase domain containing 1 ; Dual specificity phosphatase DUPD1; dupd1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q68J44
-
Expression Region
1-220aa
-
AA Sequence
MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGREL
-
Molecular Weight
51.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DUPD1 (Deletion of Ubiquitin-Proteasome Domain 1) is a protein that has garnered attention in recent years due to its potential implications in various cellular processes and disease mechanisms. Originally identified as a gene that undergoes deletion in certain cancer types, DUPD1 serves as a critical component in the regulation of protein degradation via the ubiquitin-proteasome pathway. This pathway is essential for maintaining cellular homeostasis, as it regulates protein turnover and removes misfolded or damaged proteins. Dysfunction in this system is linked to numerous diseases, including cancer, neurodegenerative disorders, and autoimmune diseases. Recent studies have indicated that alterations in the expression levels and activity of DUPD1 may contribute to tumorigenesis by affecting cell proliferation, apoptosis, and the response to stress. Moreover, the unique structure of DUPD1, which contains a ubiquitin-like domain, suggests that it may have multiple roles beyond protein degradation, including signal transduction and modulation of gene expression. Understanding the functional mechanisms of DUPD1 at a molecular level could offer new insights into targeted therapies for cancers and other diseases where proteasomal dysregulation is a key factor. Therefore, ongoing research aims to elucidate the role of DUPD1 in various biological contexts, with a focus on its potential as a biomarker or therapeutic target, emphasizing its relevance in contemporary biomedical research.
