Cat: PAX2000-12578

Recombinant Human XAGE1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    XAGE1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    X antigen family member 1. XAGE-1. Cancer/testis antigen 12.1. CT12.1. G antigen family D member 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HD64

  • Expression Region

    1-69 aa

  • AA Sequence

    MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQVLGREMRDMEGDLQELHQSNTGDKSGFGFRRQGEDNT

  • Molecular Weight

    34.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

XAGE1 is a member of the cancer/testis (CT) antigen family, which is primarily expressed in the human testis and various malignancies, including melanoma, lung cancer, and some types of breast cancer. The discovery of XAGE1 is significant due to its potential role in tumor immunotherapy, as CT antigens are often targets for cancer vaccines and other therapeutic interventions. The expression of XAGE1 in tumors but not in normal tissues, aside from the testis, makes it an attractive candidate for targeted therapies. Recent studies have focused on the generation of recombinant XAGE1 proteins to investigate their immunogenicity and potential as therapeutic agents. By expressing XAGE1 in a suitable host system, researchers aim to develop diagnostic tools and treatment modalities that harness the immune response against tumors expressing this antigen. Furthermore, recombinant XAGE1 proteins can be used to produce specific antibodies and understand the molecular mechanisms underlying its role in cancer progression, making it an essential focus of current cancer research. The exploration of XAGE1's functional properties and its interactions with immune cells could lead to novel strategies in personalized cancer treatment, providing hope for effective interventions in patients with XAGE1-expressing tumors.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US