Analytical Data
-
Gene name
XAGE2
- Application
-
Alternative Names
XAGE2; GAGED3; XAGE2BX antigen family member 2;
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96GT9
-
Expression Region
1-111 aa
-
AA Sequence
MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV
-
Molecular Weight
38.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
XAGE2, a member of the cancer/testis (CT) antigen family, has garnered increasing interest in cancer research due to its restricted expression in normal tissues and prominent upregulation in various malignancies. As an immune target, XAGE2 is primarily expressed in germ cells of the testis, making it an ideal candidate for cancer immunotherapy, particularly in tumors where it is overexpressed, such as melanoma and certain types of lung cancer. Research has shown that XAGE2 can elicit T cell responses, suggesting its potential as a target for therapeutic vaccines. Furthermore, studies indicate that the presence of antibodies against XAGE2 correlates with improved patient prognosis, highlighting its relevance in tumor immunology. Investigating the recombinant protein forms of XAGE2 may provide valuable insights into its structural and functional characteristics, facilitating the development of novel immunotherapeutic strategies. This includes the generation of XAGE2-based vaccines and engineered T cell therapies, aiming to harness the immune system to specifically target cancer cells expressing this antigen. The exploration of XAGE2 recombinant proteins not only enhances our understanding of tumor immunity but also paves the way for personalized medicine approaches in oncology, where targeting CT antigens becomes a crucial strategy in developing effective cancer treatments. As research continues to unveil the complexities of the tumor microenvironment and immune interactions, XAGE2 stands out as a promising focal point for advancing cancer immunotherapy.
