Analytical Data
-
Gene name
DUOXA1
- Application
-
Alternative Names
DUOXA1; NIP; NUMBIP; Dual oxidase maturation factor 1; Dual oxidase activator 1; Numb-interacting protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q1HG43
-
Expression Region
1-483aa
-
AA Sequence
MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTSLFIGAAILAVNFSSEWSVGQVSTNTSYKAFSSEWISADIGLQVGLGGVNITLTGTPVQQLNETINYNEEFTWRLGENYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYTSAMLWVAFLCWLLANVMLSMPVLVYGGYMLLATGIFQLLALLFFSMATSLTSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYYRPRRLSLVPADVRGLAPAALSALPGALLAQAWRALLPGLRCPKAGKESRLGPPHSPWRFGPEGCEERWAEHTGDSPRPLRGRGTGRLWRWGSKERRACGVRAMLPRLVSNSGLKRPSCLDLPKCWDYRRDARAFFHLLEPTPCVTSRHTPLI
-
Molecular Weight
79.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DUOXA1, a member of the dual oxidase (DUOX) family, plays a pivotal role in the generation of reactive oxygen species (ROS), which are essential for various physiological processes, including immune response and host defense against pathogens. The enzyme is primarily involved in the maturation and regulation of the DUOX enzymes, which produce hydrogen peroxide as a byproduct in different tissues, particularly in the thyroid gland and respiratory epithelium. Understanding DUOXA1's functional mechanisms has garnered significant attention due to its implication in several diseases, such as chronic rhinosinusitis and thyroid dysfunctions. Recent studies have highlighted the importance of DUOXA1 in promoting the stability and activity of DUOX enzymes, illustrating its potential as a therapeutic target. Furthermore, there is growing interest in the interactions between DUOXA1 and other proteins, which may influence ROS production and cellular signaling pathways. Investigating the structure and function of DUOXA1 recombinant proteins can provide insights into their role in redox signaling and disease pathology. Thus, research on DUOXA1 not only enhances our comprehension of oxidative stress-related diseases but also opens avenues for novel therapeutic strategies aimed at modulating its activity for clinical benefit.
