Analytical Data
-
Gene name
DULLARD
- Application
-
Alternative Names
CTDNEP1; DULLARD; CTD nuclear envelope phosphatase 1; Serine/threonine-protein phosphatase dullard
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95476
-
Expression Region
1-244aa
-
AA Sequence
MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW
-
Molecular Weight
54.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DULLARD, a widely studied protein, is primarily recognized for its role in embryonic development and cellular signaling processes. Initially identified in research focused on early vertebrate development, DULLARD has garnered attention due to its involvement in regulating key pathways, including those associated with the TGF-β superfamily. Its name reflects its function, as it is implicated in inhibiting certain signaling cascades that are crucial for cell differentiation and proliferation. The research surrounding DULLARD has expanded to explore its potential implications in various biological contexts, particularly in relation to stem cell biology and developmental disorders. Utilizing advanced techniques such as CRISPR/Cas9 gene editing and high-throughput screening, scientists are delving deeper into the regulatory mechanisms of DULLARD. Understanding this protein not only sheds light on fundamental biological processes but also opens avenues for therapeutic strategies in conditions where these pathways are dysregulated, such as cancer and congenital anomalies. Overall, DULLARD represents a key focus in developmental biology research, linking molecular mechanisms to broader physiological outcomes.
