Analytical Data
-
Gene name
XAGE1C
- Application
-
Alternative Names
XAGE1A; XAGE1B; XAGE1C; XAGE1D; XAGE1E
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HD64
-
Expression Region
1-81 aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV
-
Molecular Weight
11.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
XAGE1C is a member of the XAGE family of cancer/testis (CT) antigens, which are proteins typically expressed in male germ cells and various tumors, making them potential targets for immunotherapy. The study of XAGE1C is particularly relevant due to its association with malignancies, including melanoma and various other cancers. The unique expression pattern of XAGE1C, restricted to cancerous tissues and not found in normal somatic cells, positions it as a candidate for tumor-specific vaccines and targeted therapies. Research has focused on the characterization of the XAGE1C recombinant protein, exploring its immunogenic properties and potential to elicit a robust immune response against tumor cells. Advances in recombinant DNA technology have allowed for the efficient production of XAGE1C, facilitating investigations into its structure-function relationship and the mechanisms by which it may provoke an anti-tumor immune response. Understanding the role of XAGE1C in tumor biology could contribute to the development of novel diagnostic and therapeutic strategies, aiming to harness the body's immune system to recognize and eliminate cancer cells. Furthermore, exploring the expression levels of XAGE1C across different cancer types can provide insights into its potential as a biomarker for cancer diagnosis and prognosis, highlighting its clinical relevance in targeted cancer therapies. Overall, the ongoing research into XAGE1C recombinant protein holds promise for advancing cancer immunotherapy and enhancing treatment options for patients with malignancies expressing this antigen.
