Analytical Data
-
Gene name
DPPA2
- Application
-
Alternative Names
DPPA2; PESCRG1Developmental pluripotency-associated protein 2; Pluripotent embryonic stem cell-related gene 1 protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z7J5
-
Expression Region
1-298aa
-
AA Sequence
MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK
-
Molecular Weight
60.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DPPA2 (Developmental Pluripotency Associated 2) is a crucial protein primarily expressed in embryonic stem cells and is associated with pluripotency, cell differentiation, and developmental processes. Its role has gained significant attention in regenerative medicine and developmental biology research. DPPA2 belongs to a family of pluripotency factors that help maintain the undifferentiated state of stem cells and enhance their ability to self-renew. Studies have shown that DPPA2 interacts with other key transcription factors and signaling pathways involved in stem cell maintenance and differentiation. Given its importance in stem cell biology, researchers are investigating the potential of DPPA2 as a biomarker for pluripotency and its application in cell therapy and tissue engineering. Moreover, understanding the molecular mechanisms underlying DPPA2's function could provide insights into developmental disorders and cancer stem cell dynamics. The recombinant production of DPPA2 protein enables researchers to explore its functional properties, interaction with other proteins, and potential therapeutic applications. With advances in biotechnology, the ability to study DPPA2 at a molecular level holds promise for developing innovative strategies to manipulate stem cell behavior and achieve breakthroughs in regenerative medicine.
