Analytical Data
-
Gene name
TAS2R14
- Application
-
Alternative Names
TAS2R14; Taste receptor type 2 member 14; T2R14; Taste receptor family B member 1; TRB1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYV8
-
Expression Region
151-260 aa
-
AA Sequence
HINASINGYRRNKTCSSDSSNFTRFSSLIVLTSTVFIFIPFTLSLAMFLLLIFSMWKHRKKMQHTVKISGDASTKAHRGVKSVITFFLLYAIFSLSFFISVWTSERLEEN
-
Molecular Weight
37.84kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAS2R14 is a member of the TAS2R family of taste receptors, specifically known for its role in the perception of bitter tastes. These G-protein coupled receptors (GPCRs) are predominantly expressed in taste buds on the tongue, where they play a crucial role in helping organisms detect potentially harmful substances. The study of TAS2R14, in particular, has garnered interest due to its broad ligand specificity and its implications in food preference, dietary choices, and nutrition. Understanding the structural and functional characteristics of TAS2R14 can provide insights into how bitter taste perception influences behavior and potentially contributes to the development of dietary strategies for health and wellbeing. Additionally, the recombinant expression of TAS2R14 allows researchers to investigate its signaling pathways, ligand interactions, and the molecular mechanisms underlying taste perception. These studies have important implications not only for basic science but also for the food industry, where manipulating taste receptor pathways could lead to innovations in flavoring and food formulation. As research continues, TAS2R14 holds promise in elucidating the complexities of taste, which is fundamental to both human experience and survival.
