Analytical Data
-
Gene name
FOXP1
- Application
-
Alternative Names
FOXP1；Forkhead box Protein P1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H334-5
-
Expression Region
1-114aa
-
AA Sequence
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAAD LAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAET KMSGPVCQPNPSPF
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FOXP1, a member of the forkhead box family of transcription factors, plays a crucial role in various biological processes, including development, immune response, and brain function. Dysregulation of FOXP1 has been associated with several disorders, including autism spectrum disorders and intellectual disabilities, highlighting its importance in normal human development and function. The study of FOXP1 recombinant proteins aims to elucidate its structural and functional properties, as well as its interaction with other proteins and genomic elements. By producing and characterizing FOXP1 recombinant proteins, researchers can gain insights into its transcriptional regulatory mechanisms and the pathways it influences. Additionally, these studies may help identify potential therapeutic targets for diseases linked to FOXP1 mutations or dysfunctions. Given the complexity of FOXP1's role in various cell types, including lymphocytes and neurons, understanding its function at the molecular level through recombinant protein studies is essential for advancing our knowledge of its biological significance and potential implications in disease contexts.
