Cat: PAX2000-11821

Recombinant Human TAOK2 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TAOK2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    1110033K02Rik; B230344N16; hKFC C; hKFC-C; KIAA0881; Kinase from chicken homolog C; MAP3K17; mKIAA0881; Prostate derived STE20 like kinase 1; Prostate derived STE20 like kinase PSK; Prostate derived sterile 20 like kinase 1; Prostate-derived STE20-like kinase 1; PSK 1; PSK; PSK-1; PSK1; PSK1 beta; Serine/threonine protein kinase TAO2; Serine/threonine-protein kinase TAO2; TAO 1; TAO 2; TAO kinase 2; TAO1; TAO2; TAOK 2; Taok2; TAOK2_HUMAN; Thousand and one amino acid protein 2; Thousand and one amino acid protein kinase; UNQ2971/PRO7431

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UL54

  • Expression Region

    20-300  aa

  • AA Sequence

    FKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPVLQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDA

  • Molecular Weight

    kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TAOK2 (TAO Kinase 2) is a serine/threonine kinase that plays a critical role in various cellular processes, including the regulation of the mitogen-activated protein kinase (MAPK) signaling pathways, which are essential for cell growth, differentiation, and apoptosis. Recent studies have highlighted the significance of TAOK2 in neurodevelopmental and psychiatric disorders, with mutations in the TAOK2 gene being associated with conditions such as autism spectrum disorder (ASD) and intellectual disability. The functional characterization of TAOK2 is crucial for understanding its role in these diseases, as it may serve as a potential therapeutic target. Research involving the recombinant expression of TAOK2 protein allows scientists to investigate its biochemical properties, interaction with other signaling molecules, and impact on cellular functions. By studying the structure and activity of TAOK2, researchers aim to unveil the mechanisms underlying its involvement in disease pathogenesis, which could further lead to the development of novel strategies for diagnosis and treatment. Furthermore, understanding the functional dynamics of TAOK2 can provide insights into the broader implications of MAPK signaling in cellular homeostasis and the nervous system. Overall, the recombinant TAOK2 protein serves as a valuable tool for elucidating the complex signaling networks that govern critical biological processes, thereby contributing to the advancement of both basic and applied biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US