Analytical Data
-
Gene name
SYBL1
- Application
-
Alternative Names
Vesicle-associated membrane protein 7. VAMP-7. Synaptobrevin-like protein 1. Tetanus-insensitive VAMP. Ti-VAMP
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51809
-
Expression Region
1-220 aa
-
AA Sequence
MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKLTIIIIIVSIVFIYIIVSPLCGGFTWPSCVKK
-
Molecular Weight
51.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SYBL1, or Synaptobrevin-like protein 1, is a member of the synaptobrevin/VAMP family of proteins, which are critical for synaptic vesicle fusion and neurotransmitter release in neuronal cells. The role of SYBL1 in intercellular communication and signaling pathways has garnered research interest, particularly in the context of neurodevelopmental disorders and synaptic dysfunctions. Understanding SYBL1's structure and function at a molecular level can shed light on its involvement in various cellular processes, including exocytosis and membrane trafficking. Recent studies have focused on the recombinant expression of SYBL1 in heterologous systems, allowing for the examination of its functional properties and interaction with other synaptic proteins. This research has significant implications for developing therapeutic strategies targeting synaptic abnormalities associated with neurological diseases. Investigating the recombinant SYBL1 protein not only provides insights into its physiological roles but also enhances the understanding of the synaptic vesicle cycle, which is essential for maintaining proper neurotransmission and neural network functionality. By elucidating the mechanisms underlying SYBL1's action, scientists aim to contribute to the broader field of neurobiology and potentially identify novel targets for pharmacological intervention.
