Analytical Data
-
Gene name
CDA
- Application
-
Alternative Names
CDA；HR1；JPO2；R1；Cell division cycle-associated 7-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32320
-
Expression Region
1-146aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAQKRPACTLKPECVQQLLVCSQEAKQSAY CPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYK DFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQ ELLPSSFGPEDLQKTQ
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDA, short for cytidine deaminase, is an enzyme that plays a crucial role in the metabolism of nucleosides and nucleotides, particularly in the deamination of cytidine to uridine. This enzymatic process is essential for various physiological functions, including the regulation of immune responses and the synthesis of nucleic acids. Recent research into CDA has gained momentum due to its implications in cancer therapies and antiviral treatments, as its activity can influence the efficacy of nucleoside analog drugs. Understanding the structure and function of CDA through protein engineering and recombinant expression has become an important area of study. By developing recombinant CDA proteins, researchers aim to investigate their kinetic properties, identify potential inhibitors, and explore their roles in drug metabolism. Furthermore, the insights gained from CDA studies can inform the development of novel therapeutic strategies that target nucleotide metabolism, particularly in diseases where nucleotide pathways are dysregulated. The exploration of CDA recombinants is not only pivotal for enhancing our understanding of nucleoside metabolism but also holds potential for advancing treatment options in oncology and virology. Through detailed structural and functional analyses, researchers hope to unlock new avenues for drug design and improve the clinical outcomes for patients suffering from various diseases associated with aberrant CDA activity.
