Cat: PA1000-8021

Recombinant Human VGF Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VGF

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    VGF;Neurosecretory Protein VGF

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15240

  • Expression Region

    23-206aa

  • AA Sequence

    APPGRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPEVRGARNSEPQDEGELFQGVDPRALAAVLLQALDRPASPPAPSGSQQGPEEEAAEALLTETVRSQTHSLPAPESPEPAAPPRPQTPENGPEASDPSEELEALASLLQELRDFSPSSAKRQQETAAAETETRTHTLTRVNLESPGPERVW

  • Molecular Weight

    54.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

VGF (non-acronymic) is a neuropeptide precursor that plays a significant role in the regulation of energy homeostasis, neuroplasticity, and the response to stress. Originally identified in the central nervous system, VGF is encoded by the VGF gene, which produces multiple biologically active peptides through post-translational modifications. Research indicates that VGF expression is influenced by various physiological conditions, including exercise, fasting, and neurodegenerative diseases. The understanding of VGF's biological functions has attracted attention for its potential implications in metabolic disorders and mood regulation. Consequently, the recombinant production of VGF and its derived peptides is crucial for elucidating their specific roles and mechanisms in various biological contexts. This includes investigating VGF's impact on neuronal survival, synaptic plasticity, and the modulation of behavioral responses. Advances in recombinant protein technology enable the generation of active VGF peptides, facilitating in vitro and in vivo studies. Such research can contribute to the development of therapeutic strategies targeting conditions linked to VGF dysregulation, such as obesity, depression, and neurodegenerative diseases. Therefore, the study of VGF recombinant proteins stands at the intersection of neurobiology and translational medicine, paving the way for innovative approaches to understanding complex physiological processes and developing novel interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US