Analytical Data
-
Gene name
WDR22
- Application
-
Alternative Names
BCRG2; BCRP2; Breakpoint cluster region Protein 2; Breakpoint cluster region Protein; uterine leiomyoma; 2; D14S1461E; Dcaf5; DCAF5_HUMAN; DDB1 and CUL4 associated factor 5; DDB1- and CUL4-associated factor 5; WD repeat-containing Protein 22; WDR22
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96JK2
-
Expression Region
1-326 aa
-
AA Sequence
MKRRAGLGGSMRSVVGFLSQRGLHGDPLLTQDFQRRRLRGCRNLYKKDLLGHFGCVNAIEFSNNGGQWLVSGGDDRRVLLWHMEQAIHSRVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDVFAHEDAVYGLSVSPVNDNIFASSSDDGRVLIWDIRESPHGEPFCLANYPSAFHSVMFNPVEPRLLATANSKEGVGLWDIRKPQSSLLRYGGNLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHSRLPVFQFDNQGYFNSCTMKSCCFAGDRDQHHNWKWRAQAVSFQPFLSLTRNGDADVDLKLAV
-
Molecular Weight
63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WDR22, or WD repeat domain 22, is a protein that belongs to the WD repeat protein family, characterized by the presence of multiple WD repeats, which are typically involved in protein-protein interactions and play a crucial role in various cellular processes. Research has shown that WDR22 is implicated in essential biological functions, including gene regulation, cell cycle control, and signal transduction. It is expressed in a variety of tissues and has been linked to several disease states, particularly in cancer, where its dysregulation may contribute to tumor progression. Furthermore, studies suggest that WDR22 may be involved in the modulation of immune responses and has potential implications in autoimmune diseases. Given its significant roles, the recombinant expression of WDR22 is critical for detailed functional analysis and for exploring its potential as a therapeutic target. Investigating the structure and function of WDR22 through recombinant protein studies can provide insights into its specific interactions and mechanisms, potentially revealing novel pathways for intervention in diseases where WDR22 is implicated. Thus, the study of WDR22 as a recombinant protein is essential for understanding its biological significance and for developing strategies aimed at manipulating its activity for therapeutic benefits. This area of research not only enhances our understanding of fundamental cellular processes but also paves the way for potential clinical applications in targeted therapies.
