Analytical Data
-
Gene name
SURF5
- Application
-
Alternative Names
Mediator of RNA polymerase II transcription subunit 22. Mediator complex subunit 22. Surfeit locus protein 5. Surf-5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15528
-
Expression Region
1-140 aa
-
AA Sequence
MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK
-
Molecular Weight
42.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SURF5 (Surfeit 5) is a protein associated with various cellular processes, including ribosomal RNA processing and cell proliferation. Research into SURF5 has gained traction due to its potential implications in cancer biology and other diseases. The gene encoding SURF5 is located on human chromosome 3, and its expression is often elevated in certain tumor types, suggesting a potential role in oncogenesis. Studies have shown that SURF5 may interact with key regulatory proteins involved in the cell cycle and apoptosis, indicating that it could contribute to cellular growth and survival mechanisms. Furthermore, the protein's involvement in the maturation of ribosomes underscores its fundamental role in protein synthesis, which is crucial for sustaining rapid cell division in cancerous tissues. As researchers delve deeper into the molecular functions of SURF5, the development of recombinant SURF5 protein has become essential for elucidating its biological activities and interactions. This can provide insights into its precise roles in cellular processes and pave the way for novel therapeutic strategies targeting SURF5-related pathways in cancer and other diseased states. Investigating the structure, function, and regulation of SURF5 not only enhances our understanding of this protein but also opens avenues for potential biomarker development and therapeutic interventions in oncology. Overall, the study of SURF5 and its recombinant forms represents a promising area of research in understanding the molecular underpinnings of cell growth and disease.
