Analytical Data
-
Gene name
APLNR
- Application
-
Alternative Names
APLNR；AGTRL1；APJ；Apelin receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35414
-
Expression Region
1-380aa
-
AA Sequence
MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APLNR (apelin receptor) is a G protein-coupled receptor that plays a critical role in the regulation of cardiovascular, metabolic, and central nervous system functions. Recently, it has garnered interest due to its involvement in various physiological processes and its potential implications in diseases such as obesity, diabetes, and heart failure. Research has shown that the apelin/APLNR signaling pathway is linked to endothelial function, angiogenesis, and energy homeostasis, highlighting its importance in maintaining cardiovascular health. Furthermore, studies have indicated that APLNR can modulate neuroprotective effects and influence appetite regulation, making it a promising target for therapeutic interventions. Advances in protein engineering and molecular biology techniques have facilitated the study of APLNR alterations and interactions, paving the way for the development of APLNR-based therapies. Understanding the structure and function of recombinant APLNR proteins can provide insights into their signaling mechanisms and enhance our ability to design drugs that can modulate this pathway effectively. Thus, ongoing research into APLNR and its recombinant proteins is critical for elucidating their role in health and disease, opening avenues for innovative therapeutic strategies to tackle related pathologies.
