Analytical Data
-
Gene name
NT-ProANP
- Application
-
Alternative Names
NT-ProANP；
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05125
-
Expression Region
1-152aa
-
AA Sequence
MGSFSITLGFFLVLAFWLPGHIGANPVYSAVSNTDLMDFKNLLDHLEEKMPVEDEVMPPQALSEQTEEAGAALSSLPEVPPWTGEVNPPLRDGSALGRSPWDPSDRSALLKSKLRALLAGPRSLRRSSCFGGRIDRIGAQSGLGCNSFRYRR
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NT-ProANP (N-terminal pro-atrial natriuretic peptide) is a peptide that plays a crucial role in cardiovascular physiology, particularly in regulating blood pressure and fluid homeostasis. As a biomarker, NT-ProANP is synthesized in the atria of the heart and released in response to atrial wall stretching, commonly associated with volume overload conditions. Research into NT-ProANP has gained momentum due to its potential implications in diagnosing and prognosticating heart failure and other cardiovascular diseases. The recombinant production of NT-ProANP has emerged as a key area of study, facilitating the detailed investigation of its biological functions, structure-activity relationships, and potential therapeutic applications. Furthermore, generating NT-ProANP as a recombinant protein allows for high purity and yield, enabling downstream applications in drug development and clinical diagnostics. Understanding the specific roles of NT-ProANP can lead to better therapeutic strategies in managing cardiovascular disorders and further our knowledge of cardiac biology. In summary, the research of NT-ProANP recombinant proteins is essential for advancing our comprehension of cardiac function and improving patient outcomes in cardiovascular health.
