Analytical Data
-
Gene name
ALAS1
- Application
-
Alternative Names
ALAS1;von Hippel-Lindau disease tumor suppressor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13196
-
Expression Region
1-98aa
-
AA Sequence
MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALST AAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ALAS1 (Aminolevulinic Acid Synthase 1) is a key enzyme in the heme biosynthesis pathway, catalyzing the condensation of glycine and succinyl-CoA to form aminolevulinic acid (ALA), the first committed step in heme production. The importance of ALAS1 extends beyond heme synthesis; it plays a crucial role in cellular metabolism, influencing processes such as energy production and oxidative stress response. Dysregulation of ALAS1 has been implicated in various pathological conditions, including certain anemias and neurological disorders. Research has shifted towards the recombinant production of ALAS1 to facilitate studies on its biochemical properties, regulatory mechanisms, and interactions with other cellular components. Recombinant ALAS1 can be utilized to develop novel therapeutic approaches, including targeted interventions for heme-related disorders and potential applications in photodynamic therapy, where ALA serves as a precursor for protoporphyrin IX, a compound used in cancer treatment. The expression and characterization of recombinantly produced ALAS1 not only provide insights into its biological function but also pave the way for therapeutic advancements, making it an important focus in biochemical and medical research.











