Analytical Data
-
Gene name
STCH
- Application
-
Alternative Names
Heat shock 70 kDa protein 13; HEAT SHOCK 70-KD PROTEIN 13; heat shock protein 70kDa family. member 13; heat shock protein70kDa family. member13; HSP13_HUMAN; HSPA13; MGC133835; Microsomal stress 70 protein ATPase core; Microsomal stress-70 protein ATPase core; STCH; Stress 70 protein chaperone microsome associated 60 kDa protein; Stress-70 protein chaperone microsome-associated 60 kDa protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P48723
-
Expression Region
23-471 aa
-
AA Sequence
QQYLPLPTPKVIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVGYESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVTSNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSALEIPNKHLQKTNFN
-
Molecular Weight
76.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of STCH (serine/threonine-protein phosphatase with a conserved active site) recombinant proteins has gained significant attention in recent years due to their crucial role in various cellular processes. STCH proteins are involved in the regulation of signal transduction pathways, cell cycle progression, and stress responses, highlighting their importance in maintaining cellular homeostasis. Their phosphatase activity is pivotal in dephosphorylating serine and threonine residues on target proteins, which can modulate protein function and impact numerous physiological processes. Dysregulation of STCH proteins has been implicated in several diseases, including cancer, neurodegenerative disorders, and autoimmune conditions, making them potential targets for therapeutic intervention. The production of recombinant STCH proteins allows for detailed biochemical characterization, structural studies, and the development of specific inhibitors or modulators. Furthermore, understanding the structure-function relationships of STCH proteins can provide insights into their mechanisms in health and disease. Therefore, the research on STCH recombinant proteins is essential not only for basic biology but also for the development of novel therapeutic strategies.
