Cat: PAX2000-12467

Recombinant Human VN1R5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VN1R5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    VN1R5; V1RL5; Vomeronasal type-1 receptor 5; G-Protein coupled receptor GPCR26; hGPCR26; V1r-like receptor 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q7Z5H4

  • Expression Region

    1-357 aa

  • AA Sequence

    MLKLVIIENMAEIMLFSLDLLLFSTDILCFNFPSKMIKLPGFITIQIFFYPQASFGISANTILLLFHIFTFVFSHRSKSIDMIISHLSLIHILLLFTQAILVSLDFFGSQNTQDDLRYKVIVFLNKVMRGLSICTPCLLSVLQAIISPSIFSLAKLKHPSASHILGFFLFSWVLNMFIGVIFCCTLRLPPVKRGQSSVCHTALFLFAHELHPQETVFHTNDFEGCHLYRVHGPLKRLHGDYFIQTIRGYLSAFTQPACPRVSPVKRASQAILLLVSFVFTYWVDFTFSFSGGVTWINDSLLVWLQVIVANSYAAISPLMLIYADNQIFKTLQMLWFKYLSPPKLMLKFNRQCGSTKK

  • Molecular Weight

    40,7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

VN1R5 is a member of the vomeronasal receptor (VNR) family, which plays a crucial role in the detection of pheromones and other chemical cues in the environment, a process important for social and reproductive behaviors in many animal species. Research into VN1R5 has gained momentum due to its potential implications in understanding the mechanisms underlying olfactory signaling and behavior. This receptor is expressed in the vomeronasal organ (VNO), a chemosensory structure that primarily functions in the detection of non-volatile compounds, which are vital for mate selection, predator avoidance, and social communication. The interest in VN1R5 is further amplified by its evolutionary significance, providing insights into the adaptive changes in the sensory systems of different species. Studies have indicated a high degree of variability in VN1R5 across species, highlighting its role in species-specific behavior and environmental adaptation. Recent advances in molecular biology techniques have facilitated the characterization and functional analysis of VN1R5, enabling researchers to explore its receptor-ligand interactions, signal transduction pathways, and the broader physiological roles of vomeronasal receptors. Understanding VN1R5 and its functional dynamics could lead to innovative applications in fields such as ecology, evolutionary biology, and even biotechnology, particularly in developing pheromone-based control strategies in pest management. Consequently, VN1R5 serves as a valuable model for exploring the complexities of pheromone signaling and its associated behavioral repercussions in various ecological contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US