Analytical Data
-
Gene name
LAT
- Application
-
Alternative Names
LAT；Linker for activation of T-cells family member 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43561-2
-
Expression Region
28-233aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMHCHRLPGSYDSTSSDSLYPRGIQFKRPHT VAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANS VASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTP GIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTE PAALSSQEAEEVEEEGAPDYENLQELN
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LAT (Linker for Activation of T Cells) is a critical adapter protein that plays a pivotal role in T cell activation and signaling. Research on LAT is primarily motivated by its integral function in immune responses, particularly in the context of T cell receptor (TCR) signaling pathways. When T cells recognize antigens, LAT becomes phosphorylated and recruits various signaling molecules, leading to a cascade of events that ultimately enhance T cell proliferation, differentiation, and cytokine production. Understanding LAT's molecular mechanisms is essential not only for comprehending normal immune function but also for elucidating how dysregulation can contribute to autoimmune diseases, immunodeficiencies, and cancer. LAT's involvement in T cell signaling makes it a promising target for therapeutic interventions aimed at modulating immune responses, enhancing responses to vaccines, or improving cancer immunotherapies. Consequently, extensive studies have focused on the structural characterization of LAT and the identification of its binding partners, which can provide insights into the development of novel strategies for manipulating T cell responses in various clinical settings.
