Analytical Data
-
Gene name
TWIST
- Application
-
Alternative Names
TWIST；BHLHA38；TWIST；Twist-related Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15672
-
Expression Region
1-202aa
-
AA Sequence
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGA GPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSP QSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLK LAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSA SH
-
Molecular Weight
48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of TWIST recombinant proteins is rooted in the broader exploration of the TWIST gene's role in developmental biology and cancer. TWIST, a basic helix-loop-helix transcription factor, is crucial for embryonic development and the regulation of mesodermal and neural crest cell formation. Abnormal expression of TWIST has been implicated in various cancers, notably as a facilitator of epithelial-mesenchymal transition (EMT), which enhances tumor cell migration and invasion. Research has increasingly focused on characterizing TWIST's molecular mechanisms, including its influence on gene expression networks and interactions with other signaling pathways. By generating and analyzing TWIST recombinant proteins, scientists aim to better understand the functional properties of this protein, including its DNA-binding capabilities and its role in modulating cellular responses to external stimuli. Furthermore, studying TWIST proteins can provide insights into potential therapeutic targets for cancer treatment, as inhibiting TWIST activity may reverse EMT and hinder metastatic progression. This research not only contributes to our fundamental understanding of developmental processes but also holds promise for innovative approaches in oncology, making TWIST an important subject of study in both basic and applied biomedical research.
