Cat: PA1000-7962

Recombinant Human TWIST Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TWIST

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TWIST;BHLHA38;TWIST;Twist-related Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15672

  • Expression Region

    1-202aa

  • AA Sequence

    MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGA GPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSP QSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLK LAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSA SH

  • Molecular Weight

    48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of TWIST recombinant proteins is rooted in the broader exploration of the TWIST gene's role in developmental biology and cancer. TWIST, a basic helix-loop-helix transcription factor, is crucial for embryonic development and the regulation of mesodermal and neural crest cell formation. Abnormal expression of TWIST has been implicated in various cancers, notably as a facilitator of epithelial-mesenchymal transition (EMT), which enhances tumor cell migration and invasion. Research has increasingly focused on characterizing TWIST's molecular mechanisms, including its influence on gene expression networks and interactions with other signaling pathways. By generating and analyzing TWIST recombinant proteins, scientists aim to better understand the functional properties of this protein, including its DNA-binding capabilities and its role in modulating cellular responses to external stimuli. Furthermore, studying TWIST proteins can provide insights into potential therapeutic targets for cancer treatment, as inhibiting TWIST activity may reverse EMT and hinder metastatic progression. This research not only contributes to our fundamental understanding of developmental processes but also holds promise for innovative approaches in oncology, making TWIST an important subject of study in both basic and applied biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US