Analytical Data
-
Gene name
STAB2
- Application
-
Alternative Names
190 kDa form stabilin-2; 190 kDa hyaluronan receptor for endocytosis; EGF-like; FAS1 EGF-like and X-link domain-containing adhesion molecule 2; Fasciclin; FEEL-2; FEEL2; FELL; FEX2; HARE; Hyaluronan receptor for endocytosis; laminin-type EGF-like and link domain-containing scavenger receptor 2; link domain-containing scavenger receptor 2; STAB-2; Stab2; STAB2_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WWQ8
-
Expression Region
367-465 aa
-
AA Sequence
ERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFNVNELLVDNKAAQYFVKLHIIAGQMNIEYMNNTDMFYTLTGKSGEIF
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
STAB2, or Stabilin-2, is a crucial receptor primarily expressed in macrophages that plays a significant role in the regulation of immune responses and homeostasis. Research on STAB2 has garnered attention due to its involvement in various physiological and pathological processes, including the clearance of apoptotic cells, regulation of inflammation, and modulation of tissue repair. The receptor is known for its ability to recognize and internalize glycoproteins and lipoproteins, thereby influencing the turnover of these molecules and contributing to the maintenance of cellular environments. Additionally, STAB2 has been implicated in the progression of diseases, such as atherosclerosis and cancer, highlighting its potential as a therapeutic target. Recent studies have focused on the molecular mechanisms underlying STAB2 function, its signaling pathways, and its interactions with other cellular components, providing valuable insights into its role in immune regulation. Understanding the structure and function of STAB2 as a recombinant protein can advance the development of novel diagnostics and treatments, paving the way for innovative therapies that harness the receptor's biological properties. This research aims to clarify STAB2's function in health and disease, further establishing its relevance in biomedical research.
