Analytical Data
-
Gene name
TLR6
- Application
-
Alternative Names
TLR6;Toll-like receptor 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2C9
-
Expression Region
20-300aa
-
AA Sequence
IIVGTRIQFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMSQNYIAELQVSDMSFLSELTVLRLSHNRIQLLDLSVFKFNQDLEYLDLSHNQLQKISCHPIVSFRHLDLSFNDFKALPICKEFGNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRNYYIKENETESLQILNAKTLHLVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Toll-like receptors (TLRs) are crucial components of the innate immune system, responsible for recognizing pathogens and initiating immune responses. Among these, TLR6 plays a significant role in detecting lipoproteins and synergizing with other TLRs, particularly TLR2, to trigger inflammatory responses. Research into TLR6 recombinant proteins has gained momentum due to their potential applications in vaccine development, immunotherapy, and understanding immunological pathways. By studying TLR6, scientists aim to elucidate its involvement in various diseases, including infections, autoimmune disorders, and cancer. The recombinant expression of TLR6 allows for detailed characterizations of its structure and function, facilitating the exploration of its interactions with ligands and downstream signaling mechanisms. Additionally, understanding the role of TLR6 can pave the way for novel therapeutic strategies that enhance immune responses or modulate inflammation. Given the rising concern over antibiotic resistance and emerging infectious diseases, the exploration of TLR6 and its pathways holds promise for innovative approaches to enhance host defense mechanisms and improve clinical outcomes. As research progresses, the development of TLR6-based therapies may provide new avenues for treating diseases that involve dysregulated immune responses, illustrating the importance of continued investigations into this receptor's role in health and disease.











