Analytical Data
-
Gene name
ZNRF3
- Application
-
Alternative Names
ZNRF3；KIAA1133；RNF203；E3 ubiquitin-Protein ligase ZNRF3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9ULT6
-
Expression Region
56-219aa
-
AA Sequence
KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM
-
Molecular Weight
19.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNRF3 (Zinc RING Finger 3) is an E3 ubiquitin ligase that plays a crucial role in the regulation of various cellular processes, including cell differentiation, proliferation, and apoptosis. Recently, ZNRF3 has garnered attention for its involvement in the Wnt signaling pathway, a pivotal pathway in developmental biology and tumorigenesis. The aberrant regulation of the Wnt pathway is associated with various cancers, making ZNRF3 a potential therapeutic target. Research has shown that ZNRF3 interacts with Wnt receptors, promoting their degradation and thus acting as a negative regulator of Wnt signaling. Understanding the molecular mechanisms underlying ZNRF3 function can provide insights into its role in cancer biology and other diseases. The production of recombinant ZNRF3 proteins has become essential for characterizing its biochemical properties and interactions, facilitating detailed studies in various experimental contexts. Additionally, the use of recombinant techniques allows researchers to investigate the potential of ZNRF3 as a biomarker or therapeutic target in cancer treatment. Given its significant implications in cell signaling and cancer development, continued research on recombinant ZNRF3 is vital for elucidating its biological functions and developing novel therapeutic strategies.
