Analytical Data
-
Gene name
SREBF2
- Application
-
Alternative Names
SREBF2; BHLHD2; SREBP2; Sterol regulatory element-binding protein 2; SREBP-2; Class D basic helix-loop-helix protein 2; bHLHd2; Sterol regulatory element-binding transcription factor 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12772
-
Expression Region
801-900 aa
-
AA Sequence
QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SREBF2, or Sterol Regulatory Element-Binding Protein 2, is a key transcription factor that plays a crucial role in lipid metabolism and homeostasis. It primarily regulates the expression of cholesterol and fatty acid synthesis genes, making it vital for cellular and organismal health. Research into SREBF2 has gained momentum due to its implications in various metabolic disorders, including dyslipidemia, obesity, and cardiovascular diseases. Dysregulation of SREBF2 activity can lead to altered lipid profiles and contribute to the pathogenesis of these conditions. Consequently, scientists have focused on understanding the molecular mechanisms governing SREBF2 expression and function, with the aim of identifying potential therapeutic targets for metabolic diseases. The study of recombinant SREBF2 protein has provided valuable insights into its structural and functional properties, enabling more defined investigations into its role in lipid regulation. By producing and analyzing SREBF2 in a controlled environment, researchers can explore its interactions with other biomolecules, as well as the downstream signaling pathways it influences. This research not only enhances our understanding of lipid metabolism but also contributes to the development of strategies for combating metabolic diseases linked to SREBF2 dysregulation. Overall, the ongoing studies on recombinant SREBF2 protein are pivotal in elucidating its role in metabolism and its potential as a therapeutic target in metabolic-related diseases.
