Analytical Data
-
Gene name
UQCR10
- Application
-
Alternative Names
UQCR10；UCRC；Cytochrome b-c1 complex subunit 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UDW1
-
Expression Region
1-63aa
-
AA Sequence
AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
-
Molecular Weight
34.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UQCR10, or Ubiquinol-Cytochrome c Reductase 10, is a protein that plays a crucial role in the mitochondrial respiratory chain, specifically functioning in complex III as part of the electron transport chain. This protein is essential for the cellular energy production process, facilitating the transfer of electrons from ubiquinol to cytochrome c, ultimately contributing to ATP synthesis. Research on UQCR10 has gained attention due to its potential implications in various diseases, including mitochondrial disorders and neurodegenerative diseases. Alterations in UQCR10 expression or function may lead to impaired mitochondrial respiration, resulting in decreased cellular energy levels and increased oxidative stress. Studies have shown that the dysregulation of this protein can affect not only energy metabolism but also apoptosis and cellular signaling pathways. Understanding UQCR10's structure, function, and interaction with other mitochondrial components is critical for developing therapeutic strategies aimed at mitigating mitochondrial dysfunction. Consequently, the re-combinant expression and characterization of UQCR10 have become important aspects of research in cellular metabolism and disease mechanisms, paving the way for future investigations into its role in health and disease.
