Analytical Data
-
Gene name
Lingo1
- Application
-
Alternative Names
Lingo1；NOGOR；Reticulon-4 receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96FE5
-
Expression Region
241-337aa
-
AA Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSLKVLEISHWPYLDT MTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEG SMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYL
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Lingo1 (Leucine-rich repeat and immunoglobulin-like domain-containing protein 1) is a member of the LRR and Ig domain-containing protein superfamily, primarily expressed in the nervous system. It plays a crucial role in the regulation of neuronal development, axon growth, and myelination. Studies have suggested that Lingo1 functions as an inhibitory modulator in the context of central nervous system (CNS) repair, particularly by inhibiting the regeneration of damaged axons after injury. The interaction of Lingo1 with various signaling pathways, such as the Nogo receptor pathway, highlights its potential as a target for therapeutic strategies aimed at improving recovery from neurological disorders and injuries. Research on the protein structure of Lingo1 has revealed important insights into its functional domains, which mediate its interactions with ligands and other cellular components. Understanding the molecular mechanisms by which Lingo1 exerts its effects could pave the way for novel approaches in neuroregeneration and for treating conditions such as multiple sclerosis and spinal cord injuries. This research area is rapidly evolving, with ongoing investigations focusing on the role of Lingo1 in neuroinflammation and its potential as a biomarker for CNS diseases. As we delve deeper into the functional significance of Lingo1, it becomes increasingly clear that this protein could be pivotal in shaping future therapeutic paradigms for enhancing neuronal repair and regeneration.
