Cat: PA2000-3455

Recombinant Human Lingo1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Lingo1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Lingo1;NOGOR;Reticulon-4 receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96FE5

  • Expression Region

    241-337aa

  • AA Sequence

    MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSLKVLEISHWPYLDT MTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEG SMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYL

  • Molecular Weight

    15 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Lingo1 (Leucine-rich repeat and immunoglobulin-like domain-containing protein 1) is a member of the LRR and Ig domain-containing protein superfamily, primarily expressed in the nervous system. It plays a crucial role in the regulation of neuronal development, axon growth, and myelination. Studies have suggested that Lingo1 functions as an inhibitory modulator in the context of central nervous system (CNS) repair, particularly by inhibiting the regeneration of damaged axons after injury. The interaction of Lingo1 with various signaling pathways, such as the Nogo receptor pathway, highlights its potential as a target for therapeutic strategies aimed at improving recovery from neurological disorders and injuries. Research on the protein structure of Lingo1 has revealed important insights into its functional domains, which mediate its interactions with ligands and other cellular components. Understanding the molecular mechanisms by which Lingo1 exerts its effects could pave the way for novel approaches in neuroregeneration and for treating conditions such as multiple sclerosis and spinal cord injuries. This research area is rapidly evolving, with ongoing investigations focusing on the role of Lingo1 in neuroinflammation and its potential as a biomarker for CNS diseases. As we delve deeper into the functional significance of Lingo1, it becomes increasingly clear that this protein could be pivotal in shaping future therapeutic paradigms for enhancing neuronal repair and regeneration.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US